2.50 Rating by CuteStat

This website is a sub-domain of millerwelds.com. It has a global traffic rank of #92014 in the world. This website is estimated worth of $ 158,400.00 and have a daily income of around $ 220.00. As no active threats were reported recently by users, forum.millerwelds.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 18,295
Daily Pageviews: 109,770

Estimated Valuation

Income Per Day: $ 220.00
Estimated Worth: $ 158,400.00

Search Engine Indexes

Google Indexed Pages: 26,000
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 53,500
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 92,014
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.16.199.6

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Forums - Miller Welding Discussion Forums

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 4 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 2 Total Images: 6
Google Adsense: Not Applicable Google Analytics: UA-23085172-1

Websites Hosted on Same IP (i.e. 104.16.199.6)

Forums - ClinPlus Forums

- forums.clinplus.com

vBulletin Forums

4,391,753 $ 240.00

vBulletin Cloud

- gbodyolds.com

vBulletin- Site not found

Not Applicable $ 8.95

Forums - Minnesota Autosports Club

- forums.mnautox.com

vBulletin Forums --- Minnesota Autosports Club Logo Designed by Justin Tilus

Not Applicable $ 8.95

DomainFactory Forum - DomainFactory Supportforum

- forum.df.eu

DomainFactory Foren

22,473 $ 647,280.00

A Voice for Men Forums - A Voice for Men Forums

- forums.avoiceformen.com

A Voice for Men Forums

258,560 $ 34,560.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 03 Jan 2020 06:34:08 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: sameorigin
Content-Security-Policy: frame-ancestors 'self'
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Vary: Accept-Encoding
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54f2f1fb7e6fed5f-SJC
Content-Encoding: gzip

DNS Record Analysis

Host Type TTL Extra
55789f948b4f-003950.vbulletin.net A 299 IP: 104.16.198.6
55789f948b4f-003950.vbulletin.net A 299 IP: 104.16.199.6
55789f948b4f-003950.vbulletin.net A 299 IP: 104.16.200.6
55789f948b4f-003950.vbulletin.net A 299 IP: 104.16.196.6
55789f948b4f-003950.vbulletin.net A 299 IP: 104.16.197.6
forum.millerwelds.com CNAME 7199 Target: 55789f948b4f-003950.vbulletin.net
55789f948b4f-003950.vbulletin.net AAAA 300 IPV6: 2606:4700::6810:c706
55789f948b4f-003950.vbulletin.net AAAA 300 IPV6: 2606:4700::6810:c806
55789f948b4f-003950.vbulletin.net AAAA 300 IPV6: 2606:4700::6810:c406
55789f948b4f-003950.vbulletin.net AAAA 300 IPV6: 2606:4700::6810:c506
55789f948b4f-003950.vbulletin.net AAAA 300 IPV6: 2606:4700::6810:c606

Similarly Ranked Websites

Jornal Correio Paulista | A Marca da Comunicação

- correiopaulista.com
92,015 $ 158,400.00

Elite Marketing Pro | Welcome

- seanlynnwyman.elitemarketingpro.com

Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs

92,015 $ 90,000.00

Косметика Vichy. Официальный сайт на русском языке и интернет магазин

- vichyconsult.ru

Официальный интернет магазин Vichy (Виши) в России предлагает аптечную косметику по уходу за кожей и волосами. Широкий ассортимент, рекомендации по уходу за кожей, онлайн-диагностика на сайте.

92,017 $ 158,400.00

Games for Girls - AgnesGames.com

- agnesgames.com

Play free online girl games at AgnesGames.com

92,017 $ 158,400.00

A Link Directory

- alinkdirectory.info

Submit your web site free for review and inclusion to our fast growing free link directory.

92,017 $ 158,400.00